PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gorai.001G268000.2
Common NameB456_001G268000
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB_related
Protein Properties Length: 192aa    MW: 22307 Da    PI: 4.791
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gorai.001G268000.2genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding56.66.1e-183376146
                        TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                        rg +T+ E++ +++++ qlG++ W++Ia++++ gRt++++k++w++
  Gorai.001G268000.2 33 RGCFTESEEDEIIRLHSQLGNR-WSKIASHFP-GRTDNEIKNHWNT 76
                        899*******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.58E-221486IPR009057Homeodomain-like
PROSITE profilePS500904.0541427IPR017877Myb-like domain
Gene3DG3DSA:1.10.10.601.8E-51426IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.5E-262783IPR009057Homeodomain-like
PROSITE profilePS5129427.0082882IPR017930Myb domain
SMARTSM007171.5E-163280IPR001005SANT/Myb domain
PfamPF002493.5E-163376IPR001005SANT/Myb domain
CDDcd001676.73E-123676No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 192 aa     Download sequence    Send to blast
MLPLFCMVDA GLLRCGKSCR LRWINYLRPD VKRGCFTESE EDEIIRLHSQ LGNRWSKIAS  60
HFPGRTDNEI KNHWNTRIRK KLKLLGLDPV THKPIENGEK NKQEETKSED VRKDDEIQTT  120
LDGTETDDLL NNYEILCGSL DSSFSKEESN NPSMATQEED CLKQWVDCVD SFFSWDNFTH  180
LEEQIPFPPW L*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1gv2_A4e-21148237105MYB PROTO-ONCOGENE PROTEIN
1mse_C4e-21148237105C-Myb DNA-Binding Domain
1msf_C4e-21148237105C-Myb DNA-Binding Domain
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00510DAPTransfer from AT5G14340Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012445351.11e-131PREDICTED: myb-related protein 315-like
SwissprotP813947e-53MYB15_ANTMA; Myb-related protein 315
TrEMBLA0A0D2PXE01e-141A0A0D2PXE0_G
STRINGPOPTR_0001s36220.12e-70(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G14340.13e-50myb domain protein 40
Publications ? help Back to Top
  1. Paterson AH, et al.
    Repeated polyploidization of Gossypium genomes and the evolution of spinnable cotton fibres.
    Nature, 2012. 492(7429): p. 423-7
    [PMID:23257886]